PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.BC9YQ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 227aa    MW: 26122.5 Da    PI: 7.1501
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.BC9YQgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lvd ++++G g+W++ ++  g++R++k+c++rw +yl
      Araip.BC9YQ 14 KGPWTPEEDQKLVDHIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-27564IPR009057Homeodomain-like
PROSITE profilePS5129424.81965IPR017930Myb domain
SMARTSM007171.1E-151363IPR001005SANT/Myb domain
PfamPF002496.3E-181461IPR001005SANT/Myb domain
SuperFamilySSF466892.62E-241588IPR009057Homeodomain-like
CDDcd001671.06E-121661No hitNo description
Gene3DG3DSA:1.10.10.602.2E-86588IPR009057Homeodomain-like
SMARTSM007170.3766106IPR001005SANT/Myb domain
PROSITE profilePS512947.91166108IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLVDHIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILH LHSILGNNII WPDNEIKNFW NTHLKKRLIQ MGFDPMTHQP  120
RTDLFSTLPY LLALANITDF MDHHQSINTN NNSYDQNNNS ITDMEAFNLL NSITNNNVKE  180
NNPVTTFSHD EIIADSSSQP LHQSSNMLLP HLLDPQPQLW VVKAIIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-19121085108B-MYB
1h8a_C1e-191210825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1086499e-49AB108649.1 Lotus japonicus MYB102 gene for transcription factor MYB102, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016164670.11e-121PREDICTED: myb-related protein 330-like
SwissprotQ8GWP03e-60MYB39_ARATH; Transcription factor MYB39
TrEMBLQ84PP41e-107Q84PP4_LOTJA; Transcription factor MYB102
STRINGGLYMA04G11040.11e-104(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.13e-88myb domain protein 93